PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G16630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family YABBY
Protein Properties Length: 150aa    MW: 16083.2 Da    PI: 6.4872
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G16630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY51.44.3e-161256750
            YABBY  7 seqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtslls.vnl 50
                      e++ yvqC+fC t+l+vsvP +s+++vv+v+CG C+ +ls vnl
  LPERR07G16630.1 12 RERLGYVQCSFCATVLLVSVPCSSVLRVVAVQCGRCSGILSaVNL 56
                     6899************************************93444 PP

2YABBY97.53.1e-3087150103166
            YABBY 103 enedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPki 166
                       + d++vp +  +++PP ++qr Psayn+f+keei+rik   P+i+h++afs+aaknWah+P+i
  LPERR07G16630.1  87 GDADDDVPPAAVANKPPGRKQRTPSAYNCFVKEEIKRIKGMEPNITHKQAFSTAAKNWAHLPRI 150
                      4677889988999*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.0E-4112150IPR006780YABBY protein
SuperFamilySSF470953.4E-799148IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.109.7E-5101148IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSSVRDACSG VRERLGYVQC SFCATVLLVS VPCSSVLRVV AVQCGRCSGI LSAVNLPPPP  60
VVSASELDVD PPPREYSDES SEDSEGGDAD DDVPPAAVAN KPPGRKQRTP SAYNCFVKEE  120
IKRIKGMEPN ITHKQAFSTA AKNWAHLPRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2740191e-107AB274019.1 Oryza sativa Japonica Group OsYABBY7 mRNA for OsYABBY7 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657866.12e-75PREDICTED: protein YABBY 7-like
SwissprotA2PZN83e-72YAB7_ORYSJ; Protein YABBY 7
TrEMBLA0A0D9X0J41e-107A0A0D9X0J4_9ORYZ; Uncharacterized protein
STRINGOB07G25220.15e-75(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136252831
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.14e-23YABBY family protein